PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227593.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 291aa    MW: 33608 Da    PI: 6.6309
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227593.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.2e-5291331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++k++g++l +  +ike+d+yk++Pw+Lp+ +  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ + 
  XP_008227593.1   9 LPPGFRFHPTDEELVNYYLCRKCAGQPLAV-PIIKEIDLYKFDPWQLPELALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKHIGK- 101
                     79*************************999.88***************7656689*************************************98. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ g+kk Lvfy g+ap+g+kt+W+mheyrl
  XP_008227593.1 102 -PKALGIKKALVFYAGKAPRGVKTNWIMHEYRL 133
                     .778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-626160IPR003441NAC domain
PROSITE profilePS5100560.3779160IPR003441NAC domain
PfamPF023658.0E-2810133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGSGSELELP PGFRFHPTDE ELVNYYLCRK CAGQPLAVPI IKEIDLYKFD PWQLPELALY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGTGYW KATGADKHIG KPKALGIKKA LVFYAGKAPR  120
GVKTNWIMHE YRLANVDRSA SKKNNNLRLD DWVLCRIYNK KGSIEKHNVA MERSKMTKYP  180
EILHEQKPEM TQMPPPHTDM SSMDSAPRVQ QTTDYSSCSE HVLSPEVTWE KEVQSELQWS  240
SDELENSLNT LDNQFINYMD GFSDILDPFG AAQPQYQMDQ QNMFAYLQTQ F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-83516611174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227593.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-118NAC2_ARATH; NAC domain-containing protein 2
TrEMBLM5X1L40.0M5X1L4_PRUPE; Uncharacterized protein
STRINGGLYMA04G38560.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-119NAC family protein